ErbB2/Her2 anticorps (AA 29-64)

N° du produit ABIN5708082

L’anticorps Lapin Polyclonal anti-ErbB2/Her2 a été validé pour WB et IHC (p). Il convient pour détecter ErbB2/Her2 dans des échantillons de Humain et Rat.

Aperçu rapide pour ErbB2/Her2 anticorps (AA 29-64) (ABIN5708082)

Antigène: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ErbB2/Her2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ErbB2/Her2 anticorps

Épitope: AA 29-64

Purification: Antigen affinity purified

Immunogène: Amino acids 29-64 (TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY) from the human protein were used as the immunogen for the HER2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HER2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HER2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ErbB2/Her2

Antigène: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Autre désignation: HER2 / ErbB 2

Sujet: Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

UniProt: P04626

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development